PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004922-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 271aa    MW: 29883.1 Da    PI: 8.5824
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004922-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer1032e-3264121260
    ZF-HD_dimer   2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                    + +rYkeClkNhAa++Gg+a+DGCgEfmps geegt +alkC+AC+CHRnFHR++ e e
  NNU_004922-RA  64 KVIRYKECLKNHAAAMGGNATDGCGEFMPS-GEEGTLEALKCSACNCHRNFHRKDIEGE 121
                    5789*************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.3E-2966118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2566121IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015669.8E-3167117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.52468117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.3E-31198266IPR009057Homeodomain-like
SuperFamilySSF466891.35E-19201265IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-27204260IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDLSGHDGEI PIPITSSYAG GHGHGHMIHH EPSPHNHIIP SSAPQLPSNG PIHPTMEDHM  60
PYKKVIRYKE CLKNHAAAMG GNATDGCGEF MPSGEEGTLE ALKCSACNCH RNFHRKDIEG  120
ESSSCDCYHH PHLNKVAGRK VIVGPHKGVF GPEALGYPTG TLIHSRAAPP HQMIMPYSLG  180
SIPSESDEQD GGGGIVPRPP QVVKKRFRTK FTQEQKEKML GFAEKVGWRI QKQEEAVVQQ  240
FCQEIGIKRR VLKVWMHNNK HNMAKKNAPT A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-262052621875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4620677e-56AM462067.2 Vitis vinifera contig VV78X194955.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252306.10.0PREDICTED: zinc-finger homeodomain protein 4
SwissprotQ9M9S03e-75ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLF6HJZ61e-153F6HJZ6_VITVI; Putative uncharacterized protein
STRINGVIT_12s0035g01880.t011e-153(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.28e-70homeobox protein 31